SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010513 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010513
Domain Number 1 Region: 283-581
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 2.22e-111
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000296
Further Details:      
 
Domain Number 2 Region: 10-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-72
Family G proteins 0.0000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010513   Gene: ENSGGOG00000010782   Transcript: ENSGGOT00000010822
Sequence length 633
Comment pep:known_by_projection chromosome:gorGor3.1:1:91767432:91788982:1 gene:ENSGGOG00000010782 transcript:ENSGGOT00000010822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAG
QNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAV
LLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFIWTV
RDFTLELKLNGHPITEDEYLENALKLIQGKNPRVQTSNFPRECIRRFFPKRKCFVFDRPT
NDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYV
EAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKFPTDTLQELLDVHAACE
REAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMES
ISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKA
LTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSLKENIAQLKEKLQMEREH
LLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNL
ADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF
Download sequence
Identical sequences G3R5E0
ENSGGOP00000010513 ENSGGOP00000010513 XP_004026151.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]