SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010560 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010560
Domain Number 1 Region: 36-165,212-586
Classification Level Classification E-value
Superfamily SNF-like 1.01e-172
Family SNF-like 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010560   Gene: ENSGGOG00000010824   Transcript: ENSGGOT00000010872
Sequence length 642
Comment pep:known_by_projection chromosome:gorGor3.1:X:113720600:113744664:1 gene:ENSGGOG00000010824 transcript:ENSGGOT00000010872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVW
RFPYLTYSNGGGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGIT
MVLISIFVTIYYNVIIAYSVYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNK
GIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLA
LCLLLAWVIVGAALFKGIKSSGKVVYFTALFPYVVLLILLVRGATLEGASKGISYYIGAQ
SNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVVCLTNCLTSVF
AGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVLLIDHF
CAGWGILIAAILELVGIIWIYGGNRFIEDIEMMIGAKRWIFWLWWRACWFVITPILLIAI
FIWSLVQFHRPNYGAIPYPDWGVALGWCMIIFCIIWIPIMAIIKIIQAKGNIFQRLISCC
RPASNWGPYLEQHRGERYKDMVDPKKEADHEIPTVSGSRKPE
Download sequence
Identical sequences G3R5I3
ENSGGOP00000010560 ENSGGOP00000010560 XP_004064802.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]