SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010570 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010570
Domain Number 1 Region: 81-302,358-392
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.97e-39
Family Type II chitinase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010570   Gene: ENSGGOG00000010838   Transcript: ENSGGOT00000010884
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:11:797422:844893:-1 gene:ENSGGOG00000010838 transcript:ENSGGOT00000010884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESV
VLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREM
FEVTGLHDVDQGWMRAVRKHAKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQV
AKNQHFDGFVVEVWNQLLSQKRVGLIHMLTHLAEALHQARLLALLVIPPAITPGTDQLGM
FTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRACVQVLDPKSKWRSKILLGLN
FYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRSGRHVVFYPTL
KSLQVRLELARELGVGVSIWELGQGLDYFYDLL
Download sequence
Identical sequences G3R5J3
ENSGGOP00000010570 ENSGGOP00000010570 XP_004050439.1.27298 XP_004050440.1.27298 XP_004050442.1.27298 XP_018891857.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]