SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010571 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010571
Domain Number 1 Region: 343-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.11e-91
Family YicI catalytic domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 71-160,211-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000122
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 3 Region: 696-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000137
Family alpha-Amylases, C-terminal beta-sheet domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010571   Gene: ENSGGOG00000010835   Transcript: ENSGGOT00000010885
Sequence length 891
Comment pep:known_by_projection chromosome:gorGor3.1:15:20995114:21076695:1 gene:ENSGGOG00000010835 transcript:ENSGGOT00000010885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAVKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCRITANPFKVDLVSGEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEEDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTQLIREAIRERYGLLPYWYSLFYYAHVASQPVMSALLVHPVTEPKATTVDVFLPGSNE
VWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVAL
STKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSVLINSSADQRGHYPSKCVVEKILV
LGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSTLSLEKLSLTIDTDWEVRII
Download sequence
Identical sequences ENSGGOP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]