SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010596 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010596
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010596   Gene: ENSGGOG00000010869   Transcript: ENSGGOT00000010911
Sequence length 298
Comment pep:known_by_projection chromosome:gorGor3.1:5:41468701:41474730:-1 gene:ENSGGOG00000010869 transcript:ENSGGOT00000010911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCRED
SSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences H2QD25 Q9UH92
ENSGGOP00000010596 ENSP00000246912 ENSPTRP00000015681 ENSP00000246912 ENSP00000246912 ENSGGOP00000010596 gi|24586667|ref|NP_733752.1| NP_733752.1.87134 NP_733752.1.92137 XP_001163625.1.37143 XP_003813943.1.60992 ENSPTRP00000015681 9598.ENSPTRP00000015681 9606.ENSP00000246912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]