SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010606 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010606
Domain Number 1 Region: 123-225
Classification Level Classification E-value
Superfamily Rhomboid-like 1.06e-17
Family Rhomboid-like 0.0059
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000155
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010606   Gene: ENSGGOG00000010876   Transcript: ENSGGOT00000010922
Sequence length 392
Comment pep:known_by_projection chromosome:gorGor3.1:5:51853049:51910607:-1 gene:ENSGGOG00000010876 transcript:ENSGGOT00000010922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHWKVLFDQFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFV
SLMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDS
YTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLT
YIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVAELVRHEVPVQAAADGC
GPYLYEHGVWAGRVAPLPPVGLSPVPSPKLCGALGWRGRGHHPGRGGPEELRAEAPGPVT
VVDFCGHVHRLRAVRRLLEHLCLHPAGLEAAASPLRAGGPRLGRGGKSSTHREHLRGFFS
SPAQLGRADKDRRLWATVIFVFRFGHTVETLF
Download sequence
Identical sequences ENSGGOP00000010606 ENSGGOP00000010606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]