SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010617 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010617
Domain Number 1 Region: 20-76
Classification Level Classification E-value
Superfamily GLA-domain 3.03e-21
Family GLA-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010617   Gene: ENSGGOG00000010895   Transcript: ENSGGOT00000010934
Sequence length 218
Comment pep:known_by_projection chromosome:gorGor3.1:X:37830617:37940191:1 gene:ENSGGOG00000010895 transcript:ENSGGOT00000010934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVFLTGEKANSVLKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEF
WSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI
PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVN
LQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK
Download sequence
Identical sequences A0A2I3LNY2 A0A2J8WIZ9 A0A2K5HYN9 A0A2K5LY51 A0A2K5ZYY9 A0A2K6ANW1 A0A2K6PMS0 G3R5N6 H9FX86 K7D2R6 Q5RCB6
ENSPANP00000000347 9600.ENSPPYP00000022644 NP_001125319.1.23681 NP_001248011.1.72884 XP_003806021.1.60992 XP_003806022.1.60992 XP_004064032.1.27298 XP_004064033.1.27298 XP_005593330.1.63531 XP_008975540.1.60992 XP_009232979.1.23681 XP_009232980.1.23681 XP_009232981.1.23681 XP_009232982.1.23681 XP_009232983.1.23681 XP_010362397.1.97406 XP_011769734.1.29376 XP_011769735.1.29376 XP_011769736.1.29376 XP_011769737.1.29376 XP_011797303.1.43180 XP_011797313.1.43180 XP_011797321.1.43180 XP_011797330.1.43180 XP_011851693.1.47321 XP_011851694.1.47321 XP_011899419.1.92194 XP_011899420.1.92194 XP_016799183.1.37143 XP_016799184.1.37143 XP_016799185.1.37143 ENSGGOP00000010617 ENSPPYP00000022644 ENSGGOP00000010617 ENSPPYP00000022644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]