SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010631 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010631
Domain Number 1 Region: 16-201
Classification Level Classification E-value
Superfamily PR-1-like 5.62e-57
Family PR-1-like 0.00000197
Further Details:      
 
Domain Number 2 Region: 202-257
Classification Level Classification E-value
Superfamily Crisp domain-like 9.42e-17
Family Crisp domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010631   Gene: ENSGGOG00000010906   Transcript: ENSGGOT00000010948
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:6:51283253:51300166:-1 gene:ENSGGOG00000010906 transcript:ENSGGOT00000010948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQILHPALETTAMTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHN
ELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSAPS
SWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGSAYCPNQKVLKYYY
VCQYCPAGNWANRLYVPYEQGTPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKH
RLVRDSCKASCNCSNSIY
Download sequence
Identical sequences ENSGGOP00000010631 ENSGGOP00000010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]