SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010638
Domain Number 1 Region: 278-466
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-44
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 28-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-31
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010638   Gene: ENSGGOG00000010913   Transcript: ENSGGOT00000010955
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:11:6218803:6224187:1 gene:ENSGGOG00000010913 transcript:ENSGGOT00000010955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDTKVKTTESSPPAPSKARKSLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGKASQEGPPGPE
Download sequence
Identical sequences G3R5Q6
ENSGGOP00000010638 ENSGGOP00000010638 XP_018892874.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]