SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010668 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010668
Domain Number 1 Region: 45-145
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-27
Family SH2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010668   Gene: ENSGGOG00000010950   Transcript: ENSGGOT00000010986
Sequence length 441
Comment pep:known_by_projection chromosome:gorGor3.1:15:57817035:57827899:1 gene:ENSGGOG00000010950 transcript:ENSGGOT00000010986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSLKQLSLGRDPEGAGDSQALAELQELALKWFMETQAPFILQNGTLPPWFHGFITRKQ
TEQLLRDKALGSFLIRLSDRATGYILSYRGSDRCRHFVINQLRNRRYIISGDTQSHSTLA
ELVRHYQEAQLEPFKETLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFPTVVPDK
AASPRSSPKPQVSFLHAQKSLDVSPRNLSQEESMEAPIRVSPLPEKSSSLLEESFGGPSD
IIYADLRKMNQARLGLGTAGSRAYSPGREAQRRLSDGEQNRPDGLGPVLSGVSPDQGPTE
SPTSWGCSDAMGSLGATWRQEFPKLSQEAQPCSQGSSADIYEFIGTEGLLQEARDTPDQE
GSTYEQIPACWGGPARAPHPGASPTYSPWVHSYKRISGTPELSEPGNTYEQIPATKSKET
GWTHKADKLRRLFFTNRKHKF
Download sequence
Identical sequences G3R5T5
ENSGGOP00000010668 XP_004056640.1.27298 ENSGGOP00000010668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]