SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010687 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010687
Domain Number 1 Region: 162-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 14-49,98-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-18
Family Voltage-gated potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010687   Gene: ENSGGOG00000010963   Transcript: ENSGGOT00000011005
Sequence length 336
Comment pep:known_by_projection chromosome:gorGor3.1:1:213859989:213919391:1 gene:ENSGGOG00000010963 transcript:ENSGGOT00000011005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVXXXXXY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA
IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Download sequence
Identical sequences G3R5V4
ENSGGOP00000010687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]