SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010737 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010737
Domain Number 1 Region: 345-564
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.57e-53
Family Leukotriene A4 hydrolase catalytic domain 0.0044
Further Details:      
 
Domain Number 2 Region: 132-337
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.22e-51
Family Leukotriene A4 hydrolase N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010737   Gene: ENSGGOG00000011009   Transcript: ENSGGOT00000011057
Sequence length 986
Comment pep:known_by_projection chromosome:gorGor3.1:12:70808720:71212508:1 gene:ENSGGOG00000011009 transcript:ENSGGOT00000011057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEDDAALRAGGRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVL
LSLRFDECGASATPGADGGPSGFPERSGNGSLPGSARRNHHAGGDSWHPEAGGVASPGTP
SAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYV
VLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNAL
IENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLS
LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDA
IRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL
LDPSVSSISYLLDVTMVIVHEICHQEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDI
DRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRN
GKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYL
WQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNW
RLLIDQLIWNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAAS
RALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVI
MLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHS
TTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWK
FFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVE
TVEANVRWKMLYQDELFQWLGKALRH
Download sequence
Identical sequences ENSGGOP00000010737 ENSGGOP00000010737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]