SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010759 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010759
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000801
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010759   Gene: ENSGGOG00000011035   Transcript: ENSGGOT00000011079
Sequence length 502
Comment pep:known_by_projection chromosome:gorGor3.1:13:85888412:85913318:-1 gene:ENSGGOG00000011035 transcript:ENSGGOT00000011079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGTLLLYCFFLATVPALAETGRERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGN
KFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEVKFQGQH
VAKSPYILKGPVYHENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIP
KRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDVEFFVNLGDWP
LEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWES
KNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDENLYGPIVKHISFFDFF
KHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYANLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKKTKDEL
Download sequence
Identical sequences G3R624
ENSGGOP00000010759 ENSGGOP00000010759 XP_004054757.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]