SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010775 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010775
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.57e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 192-263
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 0.000000000000408
Family HCDH C-domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010775   Gene: ENSGGOG00000011053   Transcript: ENSGGOT00000011096
Sequence length 319
Comment pep:known_by_projection chromosome:gorGor3.1:13:2033113:2158118:-1 gene:ENSGGOG00000011053 transcript:ENSGGOT00000011096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAG
SLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILS
SSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG
QCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLET
MHLNAEGMLSYCDRYSEGMKHVLQTFGPIPEFSRATAEKVNQDMCMKVPDDPEHLAARRQ
WRDECLMRLAKLKSQVQPQ
Download sequence
Identical sequences G3R639
XP_004054277.1.27298 ENSGGOP00000010775 ENSGGOP00000010775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]