SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010840 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010840
Domain Number 1 Region: 195-317
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 3.14e-59
Family USP8 interacting domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-21
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 78-145
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000085
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010840
Domain Number - Region: 142-182
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0785
Family CSE2-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010840   Gene: ENSGGOG00000011122   Transcript: ENSGGOT00000011161
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:12:54285134:54304742:-1 gene:ENSGGOG00000011122 transcript:ENSGGOT00000011161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQQKRDIQLLKAYMRA
IRSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCP
ASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDD
MVQEPGLVMIFAHGVEEI
Download sequence
Identical sequences F6TUM3
ENSCJAP00000021086 ENSGGOP00000010840 ENSCJAP00000044072 ENSGGOP00000010840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]