SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010847 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010847
Domain Number 1 Region: 30-194
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.19e-61
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010847   Gene: ENSGGOG00000011126   Transcript: ENSGGOT00000011168
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:19:43240549:43244364:-1 gene:ENSGGOG00000011126 transcript:ENSGGOT00000011168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRCALLAWALLGLLRLGAAQETEDPACCSPIVPRNECKALASECTQRLSLPLRYVVVS
HTAGSSCNTPASCQQQARNVQHYRMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGH
LWNPMSIGISFMGNYMDQVPTPQAIRAAQGLLACDVAQGALRSNYVLKGHRDVQRTLSPG
DQLYNLIQNWPHYRSP
Download sequence
Identical sequences G3R6A3
XP_004061057.1.27298 ENSGGOP00000028486 ENSGGOP00000010847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]