SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010859 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010859
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000121
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010859   Gene: ENSGGOG00000011139   Transcript: ENSGGOT00000011180
Sequence length 238
Comment pep:known_by_projection chromosome:gorGor3.1:17:20768741:20775587:-1 gene:ENSGGOG00000011139 transcript:ENSGGOT00000011180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKVSCLLVS
Download sequence
Identical sequences D6RHH7
ENSGGOP00000010859 ENSP00000426097 ENSP00000426097 ENSGGOP00000010859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]