SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010874 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010874
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.000000000068
Family Cathelicidin motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010874   Gene: ENSGGOG00000011158   Transcript: ENSGGOT00000011196
Sequence length 163
Comment pep:known_by_projection chromosome:gorGor3.1:7:148791037:148794390:-1 gene:ENSGGOG00000011158 transcript:ENSGGOT00000011196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLIPLALWLGAVGVGIAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Download sequence
Identical sequences ENSGGOP00000010874 ENSGGOP00000010874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]