SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010879 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010879
Domain Number 1 Region: 31-167
Classification Level Classification E-value
Superfamily L domain-like 3.74e-25
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010879   Gene: ENSGGOG00000011161   Transcript: ENSGGOT00000011201
Sequence length 259
Comment pep:known_by_projection chromosome:gorGor3.1:7:148774952:148790873:1 gene:ENSGGOG00000011161 transcript:ENSGGOT00000011201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPAEKRGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDL
SGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAG
LPCLEYLRLRDPLARLSNPLCASPSYWAAVRELLPGLKVMDGERVIGRGSEFYQLCRDLD
SSLRPSSSPGPRATEAQPWVEPGYWESWPSRSSSILEEACRQFQDTLQECWDLDRQASDS
LAQAEQALSSAGPTSSFVF
Download sequence
Identical sequences XP_004046508.1.27298 XP_018886894.1.27298 XP_018886895.1.27298 ENSGGOP00000010879 ENSGGOP00000010879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]