SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010898 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010898
Domain Number 1 Region: 393-644
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.8e-71
Family Eukaryotic proteases 0.00007
Further Details:      
 
Domain Number 2 Region: 264-376
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-31
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 101-149
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000288
Family Fibronectin type II module 0.0035
Further Details:      
 
Domain Number 4 Region: 160-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010898
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily FnI-like domain 0.000384
Family Fibronectin type I module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010898   Gene: ENSGGOG00000011172   Transcript: ENSGGOT00000011221
Sequence length 654
Comment pep:known_by_projection chromosome:gorGor3.1:4:3527915:3535346:1 gene:ENSGGOG00000011172 transcript:ENSGGOT00000011221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHWAWVPSPCPPLGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGSQSGGLPPRPRAVPWSSSPQAQALTEDGRPCRFPFRYGGRMLH
TCTSEGSAHRKWCATTHNDRHRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQDP
QSYHCSCPRAFTGKDCGTEKCFDETRYEYLEAGDRWARVRQGHVEQCQCLGGRAWCGGTR
RTACLSSPCLNGGTCHLIVATGTTMCACPPGFAGRLCNIEPDERCFLGNGTGYHGVASTS
ASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYLVKDSALSWEY
CRLEACESLTRVQLSPDLLATLSEPASPGCQACGRRHKKRTFLRPRIIGGSSLLPGSHPW
LAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEK
YIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWG
HLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSNACQEDSGGP
LACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDSINDRIRPPRWLVAPS
Download sequence
Identical sequences ENSGGOP00000010898 ENSGGOP00000010898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]