SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010903 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010903
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-72
Family Nuclear receptor ligand-binding domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010903   Gene: ENSGGOG00000011182   Transcript: ENSGGOT00000011226
Sequence length 598
Comment pep:known_by_projection chromosome:gorGor3.1:2b:43829232:43837583:-1 gene:ENSGGOG00000011182 transcript:ENSGGOT00000011226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences A0A212C2U0 A0A2I3TIC5 A0A2K5EGS0 A0A2K5R1V9 A0A2K6SNY6 F1D8N6 G1QIL7 G3R6F3 G3TKY8 G5BQN7 H0VBV4 H2P7K7 I3M1F8 L8HXP4 L9KME5 P43354
ENSPVAP00000004970 ENSGGOP00000010903 ENSCPOP00000007396 ENSLAFP00000015516 ENSPTRP00000021447 ENSOCUP00000000680 HGL_H00000386747 ENSLAFP00000015516 ENSNLEP00000000760 IGBMC-0014-000 ENSPPYP00000014352 gi|5453822|ref|NP_006177.1| ENSPTRP00000021447 NP_006177.1.87134 NP_006177.1.92137 XP_002712233.1.1745 XP_002812539.1.23681 XP_003266169.1.23891 XP_003309349.1.37143 XP_003478736.1.53824 XP_003796003.1.62490 XP_003922016.1.74449 XP_004004735.1.66739 XP_004032710.1.27298 XP_004375453.1.4749 XP_004674701.1.23501 XP_004835987.1.39548 XP_004835988.1.39548 XP_004835989.1.39548 XP_005315846.1.77405 XP_005906446.1.15283 XP_005969191.1.78601 XP_006067612.1.26621 XP_006067613.1.26621 XP_006067614.1.26621 XP_006153609.1.99106 XP_006153610.1.99106 XP_006921145.1.64745 XP_006921146.1.64745 XP_007939999.1.48129 XP_008256815.1.1745 XP_009235994.1.23681 XP_010328452.1.74449 XP_010584613.1.64505 XP_010584614.1.64505 XP_010969618.1.22495 XP_010969619.1.22495 XP_010969620.1.22495 XP_011357511.1.92234 XP_011992362.1.66739 XP_012021593.1.54773 XP_012021594.1.54773 XP_012310330.1.9421 XP_012310332.1.9421 XP_012584217.1.23501 XP_012584219.1.23501 XP_012584223.1.23501 XP_014445269.1.99106 XP_014945908.1.54773 XP_015334677.1.40921 XP_015452173.1.64745 XP_016005578.1.101085 XP_016005579.1.101085 XP_016005580.1.101085 XP_016805323.1.37143 XP_016859708.1.92137 XP_017402614.1.71028 XP_017402620.1.71028 XP_017402622.1.71028 XP_017918693.1.57651 XP_017918696.1.57651 XP_017918701.1.57651 XP_018878284.1.27298 ENSCPOP00000007396 ENSPVAP00000004970 ENSPPYP00000014352 ENSP00000344479 ENSP00000386747 ENSGGOP00000010903 ENSP00000344479 ENSP00000386747 10141.ENSCPOP00000007396 9598.ENSPTRP00000021447 9600.ENSPPYP00000014352 9606.ENSP00000344479 9986.ENSOCUP00000000680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]