SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010916 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010916
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.4e-16
Family FHA domain 0.0022
Further Details:      
 
Domain Number 2 Region: 296-342
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000443
Family PHD domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010916   Gene: ENSGGOG00000011196   Transcript: ENSGGOT00000011239
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:6:32111446:32117141:1 gene:ENSGGOG00000011196 transcript:ENSGGOT00000011239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTVSPAPKATLILNSIG
SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEVGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPVAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT
Download sequence
Identical sequences G3R6G5
XP_004043666.1.27298 ENSGGOP00000010916 ENSGGOP00000010916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]