SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010928 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010928
Domain Number 1 Region: 184-219,257-361,475-574
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.5e-45
Family Phosphate binding protein-like 0.0000897
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010928
Domain Number - Region: 353-451
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000569
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010928   Gene: ENSGGOG00000011208   Transcript: ENSGGOT00000011252
Sequence length 795
Comment pep:known_by_projection chromosome:gorGor3.1:19:966264:975593:1 gene:ENSGGOG00000011208 transcript:ENSGGOT00000011252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSIRTLLVVRLGALLPRAPLARARARAALARAALAPRLPHNLSLELVVAAPPARDPAS
LTRGLCQALVPPGVAALLAFPEARPELLQLHFLAAATETPVLSLLRREARAPLGAPNPFH
LQFLANTSFQGRTGPVWVTGSSQVHMSRHFKVWSLRRDPRGVPAWATVGSWRDGQLDLEP
GGASARPPPPQGAQVRPKLRVVTLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDA
LFAALANGSVPRALRKCCYGYCIDLLERLAEDTPFDFELYIVGDGKYGALRDGRWTGLVG
DLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSMW
LGIFAALHLTALFLTVCEWCSPYGLTPRGRNRSTVFSYSSALNLCYAILFGRTVSSKTPK
CPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKSFEELSGIHDPKLHHPAQGFRFGTVW
ESSAEAYIKKSFPDMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDAD
CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSETLQMSIYHFSGLFVLLCLGLGSALLSSLG
EHAFFRLALPRIRKRSRLQYWLHTSQKIHRALNTEPPEGSKKETAEAEPTGPEVEQQQQQ
DQPTAPEGWKRARWAVDKERRVRFLLEPAVVVAPEADAEAEAEAEAAPREGPVWPCSNGR
PPAARPTGAPQPGELQELDRRIEVARERLRQALVRRGELLAQLGDSTRHRPRRLLQARAA
PAEAPPHSGRPGSQE
Download sequence
Identical sequences ENSGGOP00000010928 ENSGGOP00000010928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]