SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010935 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010935
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-36
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 2 Region: 204-351
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-35
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010935   Gene: ENSGGOG00000011203   Transcript: ENSGGOT00000011259
Sequence length 686
Comment pep:known_by_projection chromosome:gorGor3.1:5:95167729:95425212:-1 gene:ENSGGOG00000011203 transcript:ENSGGOT00000011259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQVPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQ
PAESNSISRITAIMENGENEGTTKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGDATVHQRRNGSKDSLMEEKPQT
STNNLAGKHTAKTIKTVQASRLKTET
Download sequence
Identical sequences G3R6I0
ENSGGOP00000010935 XP_004042397.1.27298 ENSGGOP00000010935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]