SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010981 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010981
Domain Number 1 Region: 35-369
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-117
Family Putative alpha-L-fucosidase, catalytic domain 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010981   Gene: ENSGGOG00000011262   Transcript: ENSGGOT00000011305
Sequence length 468
Comment pep:known_by_projection chromosome:gorGor3.1:6:144361056:144379907:-1 gene:ENSGGOG00000011262 transcript:ENSGGOT00000011305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPQELPRLAFPLLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFI
HWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWAD
IFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGL
YYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWN
STGFLAWLYNESPVRVTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDK
LSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSW
LKVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGA
TEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI
Download sequence
Identical sequences G3R6L9
XP_018885283.1.27298 ENSGGOP00000010981 ENSGGOP00000025925 ENSGGOP00000010981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]