SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010984 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010984
Domain Number 1 Region: 146-431
Classification Level Classification E-value
Superfamily L domain-like 1.05e-54
Family Leucine rich effector protein YopM 0.026
Further Details:      
 
Domain Number 2 Region: 391-668
Classification Level Classification E-value
Superfamily L domain-like 2.3e-46
Family Internalin LRR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010984   Gene: ENSGGOG00000011266   Transcript: ENSGGOT00000011308
Sequence length 692
Comment pep:known_by_projection chromosome:gorGor3.1:7:89404124:89418811:-1 gene:ENSGGOG00000011266 transcript:ENSGGOT00000011308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKEGMSEELEDTISQFRKESRSQSMKEPGFIKETSNLINEASDYLEGKSSNQIYETYP
RQNTLDSTSSSGKKSKRNEEQKKNLQFSETSPRTETSQSLSSLTGRTAEYQALVNFLSHE
TVGEVSPQVSEENQKQLGLGADNFTVNLEAKGLQEFPKDILKIKYVKYLYLDKNQIKTFQ
GADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLF
FYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKNLRVLNLEYNQLTIFPKALC
FLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNK
LEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNL
RKLHVNRNNMVKITDSISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFP
LGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDL
GKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICN
LKGIQKLNFSSNQFIHFPVELCQLQSLEQLNISQIKGRKNNLTALPSAIYNLFSLKEINF
DDNPLLRPPMEICKGKQLYTIARYLQRADERD
Download sequence
Identical sequences ENSGGOP00000010984 ENSGGOP00000010984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]