SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011020 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011020
Domain Number 1 Region: 286-603
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.92e-118
Family Mammalian PLC 0.000000033
Further Details:      
 
Domain Number 2 Region: 127-281
Classification Level Classification E-value
Superfamily EF-hand 1.54e-44
Family EF-hand modules in multidomain proteins 0.00023
Further Details:      
 
Domain Number 3 Region: 607-732
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.51e-29
Family PLC-like (P variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 4-116
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-21
Family Pleckstrin-homology domain (PH domain) 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011020   Gene: ENSGGOG00000014717   Transcript: ENSGGOT00000011346
Sequence length 735
Comment pep:known_by_projection chromosome:gorGor3.1:5:38963628:38973309:1 gene:ENSGGOG00000014717 transcript:ENSGGOT00000011346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLTEDEDVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHI
EAVREGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARL
DAMSQRERTHTWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSN
NDRLEGAEIEEFLRQLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQ
LIQTYEPTPAAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNT
YLTDSQIGGPSSTEAYVRYCSRGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAV
RDHAFTLSPYPVILSLENHCGLEQQAAMAHHLCTILGDMLVTQALDSPNPEELPSPEQLK
GRVLVKGKKLPAARSEDGRALSDPVQRRLVRAGMGGVGKRGKVGGRAKQISPELSALAVY
CHATRLRTLHPAPNALQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNS
ANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEY
PGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNP
RWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGAS
LSPATLFIQIRIQRS
Download sequence
Identical sequences ENSGGOP00000011020 ENSGGOP00000011020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]