SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011033 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011033
Domain Number 1 Region: 91-147
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.000000000549
Family Ribosomal protein S18 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011033   Gene: ENSGGOG00000011317   Transcript: ENSGGOT00000011360
Sequence length 235
Comment pep:known_by_projection chromosome:gorGor3.1:6:31564680:31572610:1 gene:ENSGGOG00000011317 transcript:ENSGGOT00000011360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRVC
VKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWY
NWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Download sequence
Identical sequences ENSGGOP00000011033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]