SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011039 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011039
Domain Number 1 Region: 160-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.99e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000311
Further Details:      
 
Domain Number 2 Region: 72-156
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000326
Further Details:      
 
Domain Number 3 Region: 351-426
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000612
Further Details:      
 
Domain Number 4 Region: 256-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011039   Gene: ENSGGOG00000011318   Transcript: ENSGGOT00000011366
Sequence length 572
Comment pep:known_by_projection chromosome:gorGor3.1:9:114125349:114186037:1 gene:ENSGGOG00000011318 transcript:ENSGGOT00000011366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPL
DDGVGNQLGALVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDVDSNSTIQEILIPASKVGLVIGR
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDAFKVQQAREMVLEIIREKDQADF
RGVRSDFNSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERA
AQVMGPPDRCQHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGAPGGVQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNSDPNLRRFTIRGVPQQIEVARQL
IDEKVGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPRSSGCFPNMAAKVNGNPHSTPVSGP
PAFLTQGWGSTYQAWQQPTQQVPSQQSQPQSSQPNYSKAWEDYYKKQSHAASAAPQASSP
PDYTMAWAEYYRQQVAFYGQTLGQAQAHSQEQ
Download sequence
Identical sequences G3R6S2
ENSGGOP00000011039 ENSGGOP00000011039 XP_004048795.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]