SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011088 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011088
Domain Number 1 Region: 21-164
Classification Level Classification E-value
Superfamily EF-hand 5.45e-21
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011088   Gene: ENSGGOG00000011373   Transcript: ENSGGOT00000011415
Sequence length 198
Comment pep:known_by_projection chromosome:gorGor3.1:5:156718182:156728825:1 gene:ENSGGOG00000011373 transcript:ENSGGOT00000011415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKQGSFLWYLYLDKIYCLLSVRNVKALAEYFHILDVHGKNTLNDVLFYHFLHHVTDLK
KAQINIVFDMLDWNAVGEIGFEKFYMLVCMLLAHQNHLEGQFMYRHSRPVFDLLDLKGDL
RIGAKNFEMYRFLFNIQKQELKDLFHDFDITGDNRLNYQEFKLYTIIYIDKLQKRQKTEE
KEKGERKRSLYSKCHIKQ
Download sequence
Identical sequences ENSGGOP00000011088 ENSGGOP00000011088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]