SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011141 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011141
Domain Number 1 Region: 13-118
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.78e-33
Family 6-pyruvoyl tetrahydropterin synthase 0.00000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011141   Gene: ENSGGOG00000011422   Transcript: ENSGGOT00000011469
Sequence length 118
Comment pep:known_by_projection chromosome:gorGor3.1:11:110028976:110036114:1 gene:ENSGGOG00000011422 transcript:ENSGGOT00000011469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKEAIMQP
LDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Download sequence
Identical sequences ENSGGOP00000011141 ENSGGOP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]