SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011187 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011187
Domain Number - Region: 13-48
Classification Level Classification E-value
Superfamily EF-hand 0.00238
Family Calmodulin-like 0.075
Further Details:      
 
Domain Number - Region: 359-478
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00403
Family Thioltransferase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011187   Gene: ENSGGOG00000011465   Transcript: ENSGGOT00000011515
Sequence length 529
Comment pep:known_by_projection chromosome:gorGor3.1:1:26721540:26736679:1 gene:ENSGGOG00000011465 transcript:ENSGGOT00000011515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTETGSCSVTQTGVQWCSHSSLQ
PQLPWLNSSCLSLLRSTPAASYEEEELPPDPSEETLTVEARFQPLLPETMTKSKDGFLGV
SRLALSGLRNWTAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSVFTGYLSNNRF
YPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGAVACLTAISDFYYTVMFRIHAEFQLSE
PPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPNHRSLNVDMEWLYGASESSNMEVDIG
YIPQMELEATGPSVPSVILDEDGSMIDSHLPSGETLQFVFEEIKWQQELSWEEAARRLEV
AMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCGSGRTLRETVLESSPILTL
LNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINAN
YFLDITSMKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP
Download sequence
Identical sequences ENSGGOP00000011187 ENSGGOP00000011187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]