SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011236 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011236
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-63
Family SPRY domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000366
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011236   Gene: ENSGGOG00000011522   Transcript: ENSGGOT00000011565
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:3:141280340:141372940:1 gene:ENSGGOG00000011522 transcript:ENSGGOT00000011565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ
Download sequence
Identical sequences G3R7A5 H2QNH7 Q96A44
NP_543138.1.87134 NP_543138.1.92137 XP_004037805.1.27298 XP_016797552.1.37143 ENSPTRP00000026636 ENSGGOP00000011236 ENSP00000311609 GO.33740 gi|18254460|ref|NP_543138.1| ENSGGOP00000011236 9598.ENSPTRP00000026636 9606.ENSP00000311609 ENSP00000311609 ENSP00000311609 ENSPTRP00000026636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]