SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011249 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011249
Domain Number - Region: 204-333
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0837
Family Apolipoprotein A-I 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011249   Gene: ENSGGOG00000011535   Transcript: ENSGGOT00000011579
Sequence length 417
Comment pep:known_by_projection chromosome:gorGor3.1:8:95199136:95221311:-1 gene:ENSGGOG00000011535 transcript:ENSGGOT00000011579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDSCFLQWGFKT
YRTSSLWNSSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLS
PMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLL
RLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADV
AQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV
YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLF
KVRERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL
Download sequence
Identical sequences G3R7B6
XP_004047379.1.27298 ENSGGOP00000011249 ENSGGOP00000011249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]