SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011258 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011258
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-38
Family C-type lectin domain 0.0000000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011258   Gene: ENSGGOG00000011544   Transcript: ENSGGOT00000011588
Sequence length 178
Comment pep:known_by_projection chromosome:gorGor3.1:2a:80581297:80583923:-1 gene:ENSGGOG00000011544 transcript:ENSGGOT00000011588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDTMLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLS
PKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSISNSYSYVWIGLHDPTQGTEPNG
EGWEWSSSDVMNYFAWERNPSTVSSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Download sequence
Identical sequences ENSGGOP00000011258 ENSGGOP00000011258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]