SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011271 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011271
Domain Number 1 Region: 59-274,434-540
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.05e-41
Family WD40-repeat 0.023
Further Details:      
 
Domain Number 2 Region: 363-411,452-538,912-1010
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000489
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1088-1144
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000382
Family SNARE fusion complex 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011271   Gene: ENSGGOG00000016875   Transcript: ENSGGOT00000011601
Sequence length 1152
Comment pep:known_by_projection chromosome:gorGor3.1:6:148138204:148325805:1 gene:ENSGGOG00000016875 transcript:ENSGGOT00000011601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFNIRKVLDGLTAGSSSASQQQQQQQHPPGNREPEIQETLQSEHFQLCKTVRHGFPYQ
PSALAFDPVQKILAVGTQTGALRLFGRPGVECYCQHDSGAAVIQLQFLINEGALVSALAD
DTLHLWNLRQKRPAILHSLKFCRERVTFCHLPFQSKWLYVGTERGNIHIVNVESFTLSGY
VIMWNKAIELSSKSHPGPVVHISDNPMDEGKLLIGFESGTVVLWDLKSKKADYRYTYDEA
IHSVAWHHEGKQFICSHSDGTLTIWNVRSPAKPVQTITPHGKQLKDGKKPEPCKPILKVE
FKTTRSGEPFIILSGGLSYDTVGRRPCLTVMHGKSTAVLEMDYSIVDFLTLCETPYPNDF
QEPYAVVVLLEKDLVLIDLAQNGYPIFENPYPLSIHESPVTCCEYFADCPVDLIPALYSV
GARQKRQGYSKKEWPINGGNWGLGAQSYPEIIITGHADGSVKFWDASAITLQVLYKLKTS
KVFEKSRNKDDRPNTDIVDEDPYAIQIISWCPESRMLCIAGVSAHVIIYRFSKQEVITEV
IPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPC
LKVKNSPLKQSPGYQTELVIQLVWVGGEPPQQITSLAVNSSYGLVVFGNCNGIAMVDYLQ
KAVLLNLGTIELYGSNDPYRREPRSPRKSRQPSGAGLCDISEGTVVPEDRCKSPTSGSSS
PHNSDDEQKMNNFIEKVKTKSRKFSKMVANDIAKMSRKLSLPTDLKPDLDVKDNSFSRSR
SSSVTSIDKESREAISALHFCETFTRKTDSSPSPCLWVGTTLGTVLVIALNLPPGGEQRL
LQPVIVSPSGTILRLKGAILRMAFLDTTGCLIPPAYEPWREHNVPEEKDEKEKLKKRRPV
SVSPSSSQEISENQYAVICSEKQAKVISLPTQNCAYKQNITETSFVLRGDIVALSNSICL
ACFCANGHIMTFSLPSLRPLLDVYYLPLTNMRIARTFCFTNNGQALYLVSPTEIQRLTYS
QETCENLQEMLGELFTPVETPEAPNRGFFKGLFGGGAQSLDREELFGESSSGKASRSLAQ
HIPGPGGIEGVKGAASGVVGELARARLALDERGQKLGDLEERTAAMLSSAESFSKHAHEI
MLKYKDKKWYQF
Download sequence
Identical sequences G3R7D6 H2QTV9
ENSPTRP00000031893 ENSGGOP00000011271 ENSPTRP00000031893 XP_003311579.1.37143 XP_003811576.1.60992 XP_018885411.1.27298 ENSGGOP00000011271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]