SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011303 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011303
Domain Number 1 Region: 376-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000222
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011303
Domain Number - Region: 98-108
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011303   Gene: ENSGGOG00000011586   Transcript: ENSGGOT00000011633
Sequence length 491
Comment pep:known_by_projection chromosome:gorGor3.1:11:32898544:32958193:-1 gene:ENSGGOG00000011586 transcript:ENSGGOT00000011633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPEQQGVRDPGGIWVKLGAAEASAERLQGRRSRGASGSEPQQMGSDVRDLNALLPAVPSL
GGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSW
GGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCL
ESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPP
VYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSV
KWTEGQSNHGTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETS
EKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHT
GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH
QRNMTKLQLAL
Download sequence
Identical sequences G3R7G6
ENSGGOP00000011303 ENSGGOP00000011303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]