SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011317 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011317
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.12e-33
Family Gelsolin-like 0.00000155
Further Details:      
 
Domain Number 2 Region: 134-238
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.25e-28
Family Gelsolin-like 0.00000156
Further Details:      
 
Domain Number 3 Region: 244-347
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.89e-25
Family Gelsolin-like 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011317   Gene: ENSGGOG00000011604   Transcript: ENSGGOT00000011647
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:2a:86912086:86928035:-1 gene:ENSGGOG00000011604 transcript:ENSGGOT00000011647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVARENQGVFFSGDAYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQFFKDWK
Download sequence
Identical sequences G3R7I0
ENSGGOP00000011317 ENSGGOP00000011317 XP_004029586.1.27298 XP_004029587.1.27298 XP_018876394.1.27298 XP_018876395.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]