SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011355 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011355
Domain Number 1 Region: 1919-2224
Classification Level Classification E-value
Superfamily Aspartate/ornithine carbamoyltransferase 7.99e-101
Family Aspartate/ornithine carbamoyltransferase 0.000000249
Further Details:      
 
Domain Number 2 Region: 514-782
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-95
Family BC ATP-binding domain-like 0.000000448
Further Details:      
 
Domain Number 3 Region: 1047-1305
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.01e-84
Family BC ATP-binding domain-like 0.0000129
Further Details:      
 
Domain Number 4 Region: 1466-1746
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 8.67e-78
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.0000644
Further Details:      
 
Domain Number 5 Region: 148-359
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.93e-53
Family Class I glutamine amidotransferases (GAT) 0.0000368
Further Details:      
 
Domain Number 6 Region: 2-149
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 1.44e-51
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000631
Further Details:      
 
Domain Number 7 Region: 777-927
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.32e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00023
Further Details:      
 
Domain Number 8 Region: 932-1048
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-45
Family BC N-terminal domain-like 0.0000255
Further Details:      
 
Domain Number 9 Region: 393-513
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.3e-42
Family BC N-terminal domain-like 0.0000374
Further Details:      
 
Domain Number 10 Region: 1312-1468
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.14e-24
Family Inosicase 0.018
Further Details:      
 
Domain Number 11 Region: 1745-1813
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 2.12e-18
Family Hydantoinase (dihydropyrimidinase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011355   Gene: ENSGGOG00000011620   Transcript: ENSGGOT00000011687
Sequence length 2225
Comment pep:known_by_projection chromosome:gorGor3.1:2a:27687128:27718068:1 gene:ENSGGOG00000011620 transcript:ENSGGOT00000011687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPQDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETVELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTEIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM
KRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLN
ETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTMAAVLMVAQLTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVI
DCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASD
PGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHS
LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPTVRGFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF
Download sequence
Identical sequences G3R7L6
XP_004029035.1.27298 ENSGGOP00000011355 ENSGGOP00000011355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]