SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011386 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011386
Domain Number 1 Region: 992-1331
Classification Level Classification E-value
Superfamily NHL repeat 3.14e-23
Family NHL repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 1229-1470
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000262
Family SGL-like 0.07
Further Details:      
 
Domain Number 3 Region: 687-758
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000049
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 396-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000051
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011386
Domain Number - Region: 526-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 429-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 496-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 562-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 362-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 333-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011386   Gene: ENSGGOG00000011659   Transcript: ENSGGOT00000011718
Sequence length 2532
Comment pep:known_by_projection chromosome:gorGor3.1:unplaced:67829809:68075507:-1 gene:ENSGGOG00000011659 transcript:ENSGGOT00000011718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPGGLQNHARLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPP
AGGAQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILGASRHDGAYSDGHF
LFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAALS
AIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTG
LETPDRKGKGTTEFDFVELLDGRRLLTQEARSLEGTPRQSRGTVPPSSHETGFIQYLDSG
IWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASC
PVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNHGTCITGTCICNPGYKGESC
EEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTGLCSCDP
SWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCEC
SPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGAGCDTSMETA
CGDSKDNDGDGLVDCMDPDCCLQPLCHINLLCLGSPNPLDIIQETQVPVSQQNLHSFYDR
IKFLVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQD
GSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETIIMRHEENEIPSCDLSNFA
RPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEISISGCKMRLSYLSSRTPGYKSVLRI
SLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVS
VGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVS
QQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPS
GNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDSSSRRVFKIKSTVVVKDLVKN
SEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRIDQNGI
ISTLLGSNDLTSARPLSCDSVMDISQVHLEWPTDLAINPMDNSLYVLDNNVVLQISENHQ
VRIIAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEKKINRIRQV
TTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGELYVADLGN
IRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTTGKHLYTQSLPTGDYLYNFTYTGDGD
ITLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELAMMTYHG
NSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDVT
ITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVNPTVGK
RNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHR
KFTLRILYDQAGRPSLWSPSSRLNGVNVTYSTGGHIAGIQRGIMSERMEYDQAGRITSRI
FADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETIRSVGYYRN
IYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDET
AGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQAV
INETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRMKEVQYE
IFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRYSY
DLNGNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKMDEDGFLRQRGGDIFEYNSAGLL
IKAYNRAGSWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVTHLYNHSSSEITSL
YYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQ
IIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSSNVMPFNLYMFKNNNP
ISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYELIHTQMKTQEWDNSK
SILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPKTKKFASSGSVFGKGVKFALKDG
RVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVDTHYFVKPGPSEGDLAILGLSGG
RRTLENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCLNTRYGTTLDEEKARVLELARQR
AVRQAWAREQQRLREGEEGLRAWTEGEKQQMLSTGRVQGYDGFFVISVEQYPELSDSANN
IHFMRQSEMGRR
Download sequence
Identical sequences ENSGGOP00000011386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]