SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011422 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011422
Domain Number 1 Region: 31-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.88e-130
Family Myeloperoxidase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 803-942
Classification Level Classification E-value
Superfamily EF-hand 3.23e-28
Family Calmodulin-like 0.0058
Further Details:      
 
Domain Number 3 Region: 1267-1366
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.81e-16
Family Ferredoxin reductase FAD-binding domain-like 0.0091
Further Details:      
 
Domain Number 4 Region: 1377-1533
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000000000563
Family Flavohemoglobin, C-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011422   Gene: ENSGGOG00000011693   Transcript: ENSGGOT00000011755
Sequence length 1545
Comment pep:known_by_projection chromosome:gorGor3.1:15:23835417:23855876:-1 gene:ENSGGOG00000011693 transcript:ENSGGOT00000011755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRARPEALMLLGALLTGSLDPSGSQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRR
VPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVE
TPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLD
GSAIYGSSHSWSDALRSFSRGQLASGPDPAFPRHSQNPLLMWAAPDPATGQNGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQDVEARS
VSPHHHRLLPAGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKGFQS
SQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKFSRT
DYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLAQLE
LLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTLRDV
LVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAITII
ALCCLPLVSLLLSGVVAYFRGRERKKLQKKVKESVKKEAAKDGVPAMEWPGPKERSSPII
IQLLSDRCLQVLNRRLTVLRVVQLQPLQQVNLILSNNRGCHTLLLKIPKEYDLVLLFSSE
EERGAFVQQLRDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVLDIN
QADAGTLPLDSCQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFRE
FLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQLAEV
VESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGSGSGIRDIFKQNISCR
VSFITRTPGERSHPQGLGPHAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQRGF
LAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGIILS
RGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAILHSA
GHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLAIMY
VFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGDKLV
SLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSA
PHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVSVLV
GGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIREVEENDHQD
LVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQ
EVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF
Download sequence
Identical sequences ENSGGOP00000011422 ENSGGOP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]