SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011425 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011425
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily E set domains 4.67e-70
Family Arrestin/Vps26-like 0.0000000639
Further Details:      
 
Domain Number 2 Region: 188-392
Classification Level Classification E-value
Superfamily E set domains 1.12e-60
Family Arrestin/Vps26-like 0.0000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011425   Gene: ENSGGOG00000011713   Transcript: ENSGGOT00000011758
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:2b:122540309:122579515:1 gene:ENSGGOG00000011713 transcript:ENSGGOT00000011758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGKTSKSELNHVIFKKISRDKSVTIYLGKRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEAVQTSSCLSKTLTLLPLLANNRERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDIDE
Download sequence
Identical sequences ENSGGOP00000011425 ENSGGOP00000025958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]