SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011436 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011436
Domain Number 1 Region: 213-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.48e-27
Family SPRY domain 0.019
Further Details:      
 
Domain Number 2 Region: 454-604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000125
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000641
Family SAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011436   Gene: ENSGGOG00000011722   Transcript: ENSGGOT00000011769
Sequence length 748
Comment pep:known_by_projection chromosome:gorGor3.1:11:59499728:59511821:-1 gene:ENSGGOG00000011722 transcript:ENSGGOT00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAE
PRPVAASGGGPGGDEEEDEEEEEEEDEEALLEDEDEEPPPAQALGQAAQPPPEPPEAAAM
EAAAEPDASEKPAEATAGSGGVNGGEEQGPGKGEEDEPEERSGDETPGSEVPGDKAAEEQ
GDDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPPEEEAKDE
EEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGARSTYGVTKGKVCFEAKVT
QNLPMKEGCTEVSLLRVGWSVDFSHPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGEND
VIGCFANFETEEVELSFSKNGEDLGVAFWISKDSLADRALLPHVLCKNCVVELNFGQKEE
PFFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPGSGKTQWALKYAKENPEK
RYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCN
VYNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLP
EKCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQG
YVGGQRRGYDNRAYGQQYWGQPGNRGGYRNFYDRYRGDYDRFYGRDYEYNRYRDYYRQYN
RDWQSYYYHHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences G3R7T9
ENSGGOP00000011436 ENSGGOP00000011436 XP_004051414.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]