SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011453 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011453
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011453   Gene: ENSGGOG00000011746   Transcript: ENSGGOT00000011786
Sequence length 199
Comment pep:known_by_projection chromosome:gorGor3.1:11:62433504:62434778:1 gene:ENSGGOG00000011746 transcript:ENSGGOT00000011786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPAPVVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL
CGLIRACAEALRSLQQLQH
Download sequence
Identical sequences G3R7V6
ENSGGOP00000011453 ENSGGOP00000011453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]