SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011478
Domain Number 1 Region: 5-36,86-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-17
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 2 Region: 165-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000275
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011478   Gene: ENSGGOG00000011766   Transcript: ENSGGOT00000011811
Sequence length 307
Comment pep:known_by_projection chromosome:gorGor3.1:11:62455926:62459075:-1 gene:ENSGGOG00000011766 transcript:ENSGGOT00000011811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLRPWARYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAAHRACLPP
GALEELLGTALATQAHGVSSLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKA
FCMVYAALGLPASLALMATLRHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVAS
SFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGVEDLLPGHGRSLHPVIYHLGQLALLG
YLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAQA
SGQAPAC
Download sequence
Identical sequences G3R7Y0
ENSGGOP00000011478 ENSGGOP00000011478 XP_004051565.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]