SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011481 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011481
Domain Number 1 Region: 189-254
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011481   Gene: ENSGGOG00000011776   Transcript: ENSGGOT00000011814
Sequence length 333
Comment pep:known_by_projection chromosome:gorGor3.1:1:48853506:48863096:-1 gene:ENSGGOG00000011776 transcript:ENSGGOT00000011814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAPAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSHSGFFGEPDAFPMFTTNNRVKRRPSPYEMEI
TDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINF
LAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGA
ASPDSYTEEPAPKHTARSLHPAMLPAADGASPR
Download sequence
Identical sequences ENSGGOP00000011481 ENSGGOP00000026129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]