SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011490
Domain Number 1 Region: 18-90
Classification Level Classification E-value
Superfamily Homeodomain-like 3.51e-18
Family Homeodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011490   Gene: ENSGGOG00000011784   Transcript: ENSGGOT00000011823
Sequence length 237
Comment pep:known_by_projection chromosome:gorGor3.1:20:34013488:34032535:1 gene:ENSGGOG00000011784 transcript:ENSGGOT00000011823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL
SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPA
PTNVLSLSVCSMPLHSGQGEKSAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
NTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Download sequence
Identical sequences G3R7Z0
XP_004062148.1.27298 XP_004062149.1.27298 XP_004062150.1.27298 XP_004062151.1.27298 XP_004062152.1.27298 XP_018872503.1.27298 ENSGGOP00000011490 ENSGGOP00000011490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]