SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011501
Domain Number 1 Region: 100-225
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000186
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011501
Domain Number - Region: 330-409
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0196
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011501   Gene: ENSGGOG00000011785   Transcript: ENSGGOT00000011834
Sequence length 669
Comment pep:known_by_projection chromosome:gorGor3.1:19:17871296:17905325:1 gene:ENSGGOG00000011785 transcript:ENSGGOT00000011834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPDRKEVPLSQGTQAVVVGKGRGAPGDGSSMGGRPSSPLDKQQRQHLRGQVDTLLRNFL
PCYRGQLAASVLRQISRELGPQEPAGSQLLRSKKLPRVREHRGPLTQLRGHPPRWQPIFC
VLRGDGRLEWFSHKEEYENGGHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEE
PDSLLEVPVSFPLFLQHPFRRHLCFSAATREAQHAWRLALQGGIRLQGTVLQRSQAPAAR
AFLDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLPALRAQTLPGLRGAGRARAWA
WTELLDAVHAAVLAGASAGLCAFQPEKDELLASLEKTIRPDVDQLLRQRARVAGRLRTDI
RGPLESCLRREVDPQLPRVVQTLLRTVEASLEAVRTLLAQGMDRLSHRLRQSPSGTRLRR
EVYSFGEMPWDLALMQTCYCEAERSRGRLGQLAAPFGFLGMQSLVFGAQDLAQQLMADAV
ATFLQLADQCLTTALNCDQAAQRLERVRGRVLKKFKSDSGLAQRRFIRGWGLCIFLPFML
SHLEPGCKKELPEFEGDVLAMGSQALTTEGIYEDVIRGCLLQRIDQAPNLNLVSSFLAGR
QAFTDFLCLPAKSSANWILAASPLSCSCFRNGFHRDSPVFLVQLAEGLSHSMETVSSHSV
WSFQPTPRQ
Download sequence
Identical sequences ENSGGOP00000011501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]