SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011513 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011513
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000237
Family Pentraxin (pentaxin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011513   Gene: ENSGGOG00000011805   Transcript: ENSGGOT00000011846
Sequence length 132
Comment pep:novel chromosome:gorGor3.1:1:138288504:138288899:1 gene:ENSGGOG00000011805 transcript:ENSGGOT00000011846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAFIFPQESATVYVSLIPKVKKPLKNFTLCLKTFTDFTCPYSLFYSTRSQDNELLLLVNK
MGMYLLHIGNAAVTFNGPTPCPRSPYASTHVNVSWESASGIAALWANGKLVGRKGVWKGY
SVGEEAKIILGQ
Download sequence
Identical sequences ENSGGOP00000011513 ENSGGOP00000011513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]