SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011525 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011525
Domain Number 1 Region: 56-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-29
Family G proteins 0.03
Further Details:      
 
Domain Number 2 Region: 445-534
Classification Level Classification E-value
Superfamily EF-hand 3.57e-22
Family Eps15 homology domain (EH domain) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011525   Gene: ENSGGOG00000011817   Transcript: ENSGGOT00000011858
Sequence length 541
Comment pep:known_by_projection chromosome:gorGor3.1:15:20612870:20686692:-1 gene:ENSGGOG00000011817 transcript:ENSGGOT00000011858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWMGRQAGGRERAGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVK
AMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEEMSTPTQLVQGGAFDGT
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPIDGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKA
D
Download sequence
Identical sequences G3R825
ENSGGOP00000011525 ENSGGOP00000011525 XP_004056086.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]